PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 25644
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family GATA
Protein Properties Length: 386aa    MW: 43066.9 Da    PI: 6.9143
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
25644genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA33.17.8e-11185217436
   GATA   4 CgttkTplWRrgpdgnktLCnaCGlyyrkkglk 36 
            C  +kTpl+Rrgpdg  tLCnaCGl + ++ ++
  25644 185 CDCSKTPLMRRGPDGIGTLCNACGLWWSRHQTM 217
            67889************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.2E-6174229IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.18E-9178221No hitNo description
Gene3DG3DSA:3.30.50.102.3E-12178219IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.88E-11179218No hitNo description
PROSITE patternPS003440180207IPR000679Zinc finger, GATA-type
PfamPF003205.5E-8180216IPR000679Zinc finger, GATA-type
PROSITE profilePS5011410.449185236IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MRAEPLDATA SNASASSPRE TRKRAREAIF ARFDALATAR GAKLAKRRGK RNCVELELEA  60
LGGVSDETLA KFATYGDKVQ KMMQKATPRG ATPGLAPIRY AARGTLFNEP YRVSVDEQGV  120
HRVVWGKEGE SRRVVRSKDG ARTPQEAVEC VHVEILRRMN ENIASVSDES HDGTFEARIC  180
RNCLCDCSKT PLMRRGPDGI GTLCNACGLW WSRHQTMREY PSVVPEETPH KAIFIRNPVK  240
SRRALKTLDV FGYYSSSVQA TLAKACAAVL QEERRSLRLP RVKSKPDVRY DFKRAIHDVF  300
DRCDCVFADS PSHSDDLGWE HYPPSITDFA AEQLEELEGV KLEGVKLEGV KLEGVELEGV  360
ELEELELEEL EAFAFGFEPP RLDPV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00369DAPTransfer from AT3G21175Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0005960.0CP000596.1 Ostreococcus lucimarinus CCE9901 chromosome 16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001421825.10.0predicted protein
TrEMBLA4S8V30.0A4S8V3_
STRINGA4S8V30.0(Ostreococcus lucimarinus CCE9901)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP813455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21175.21e-14ZIM-like 1